PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01198.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 240aa    MW: 26853 Da    PI: 5.1926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01198.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-131565148
                             TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ed +lvd  +  Gg    +W+ +++  g++R++k+c++rw +yl
  Rsa1.0_01198.1_g00007.1 15 KGPWTADEDGKLVDFLRTRGGSggwCWRDVPKLAGLRRCGKSCRLRWTNYL 65
                             79******************99***************************97 PP

2Myb_DNA-binding56.94.9e-1871115147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +++eE +l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Rsa1.0_01198.1_g00007.1  71 RGLFSEEEIQLVIDLHAQLGNR-WSKIAAELP-GRTDNDIKNYWNTH 115
                              7889******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-17668IPR009057Homeodomain-like
PROSITE profilePS5129412.3221065IPR017930Myb domain
SuperFamilySSF466893.15E-2412112IPR009057Homeodomain-like
SMARTSM007177.3E-61467IPR001005SANT/Myb domain
PfamPF002492.4E-111565IPR001005SANT/Myb domain
CDDcd001679.93E-51765No hitNo description
PROSITE profilePS5129427.15566120IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2669121IPR009057Homeodomain-like
SMARTSM007172.3E-1770118IPR001005SANT/Myb domain
PfamPF002493.6E-1671115IPR001005SANT/Myb domain
CDDcd001672.94E-1374116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGGRKPCCDE VGLRKGPWTA DEDGKLVDFL RTRGGSGGWC WRDVPKLAGL RRCGKSCRLR  60
WTNYLRPDLK RGLFSEEEIQ LVIDLHAQLG NRWSKIAAEL PGRTDNDIKN YWNTHIKRKL  120
IRMGIDPNTH HPFDQQKVNR EKEETTLVNG GNPRDETEVP VGLQNDTSAG NLNHLADVDG  180
DSIQPWSFLM ENDGGGCSSA GELTMLLSGD ITSSCSSSSS LWLKYGEFGY EDFELGCFDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27131205108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00577DAPTransfer from AT5G62320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627225.11e-158PREDICTED: protein ODORANT1
RefseqXP_013627224.11e-158PREDICTED: protein ODORANT1
SwissprotQ50EX62e-69ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D3BFT81e-158A0A0D3BFT8_BRAOL; Uncharacterized protein
STRINGAT5G62320.11e-129(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62320.11e-131myb domain protein 99